Recombinant Human CRYAA protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens crystallin alpha A (CRYAA) (NM_000394).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P02489
Entry Name CRYAA_HUMAN
Gene Names CRYAA CRYA1 HSPB4
Alternative Gene Names CRYA1 HSPB4
Alternative Protein Names Alpha-crystallin A chain (Heat shock protein beta-4) (HspB4) [Cleaved into: Alpha-crystallin A(1-172); Alpha-crystallin A(1-168); Alpha-crystallin A(1-162)]
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 173
Molecular Weight(Da) 19909
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Background
Function FUNCTION: Contributes to the transparency and refractive index of the lens (PubMed:18302245). In its oxidized form (absence of intramolecular disulfide bond), acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions (PubMed:22120592, PubMed:31792453, PubMed:18199971, PubMed:19595763). Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA (PubMed:28935373). {ECO:0000269|PubMed:18199971, ECO:0000269|PubMed:19595763, ECO:0000269|PubMed:22120592, ECO:0000269|PubMed:28935373, ECO:0000269|PubMed:31792453, ECO:0000303|PubMed:18302245}.
Pathway
Protein Families Small heat shock protein (HSP20) family
Tissue Specificity Expressed in the eye lens (at protein level). {ECO:0000269|PubMed:12356833, ECO:0000269|PubMed:23255486}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8790935

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CRYAA protein
Copyright © 2021-present Echo Biosystems. All rights reserved.